A new antiproliferative and antioxidant peptide isolated from Arca subcrenata

Mar Drugs. 2013 May 24;11(6):1800-14. doi: 10.3390/md11061800.

Abstract

A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNH DGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRK NNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/ TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC₅₀ values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively.

Publication types

  • Research Support, Non-U.S. Gov't

MeSH terms

  • Amino Acid Sequence
  • Animals
  • Antineoplastic Agents / administration & dosage
  • Antineoplastic Agents / isolation & purification
  • Antineoplastic Agents / pharmacology*
  • Antioxidants / administration & dosage
  • Antioxidants / isolation & purification
  • Antioxidants / pharmacology*
  • Chromatography / methods
  • Chromatography, High Pressure Liquid / methods
  • Chromatography, Ion Exchange / methods
  • Chromatography, Reverse-Phase / methods
  • Free Radical Scavengers / administration & dosage
  • Free Radical Scavengers / isolation & purification
  • Free Radical Scavengers / pharmacology
  • HT29 Cells
  • HeLa Cells
  • Hep G2 Cells
  • Humans
  • Inhibitory Concentration 50
  • Isoelectric Point
  • Molecular Weight
  • Mollusca / chemistry*
  • Neoplasms / drug therapy
  • Neoplasms / pathology
  • Peptides / administration & dosage
  • Peptides / isolation & purification
  • Peptides / pharmacology*
  • Spectrometry, Mass, Electrospray Ionization

Substances

  • Antineoplastic Agents
  • Antioxidants
  • Free Radical Scavengers
  • Peptides